Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sciurus carolinensis Medium-wave-sensitive opsin 1 (OPN1MW)

This Recombinant Sciurus carolinensis Medium-wave-sensitive opsin 1 (OPN1MW) spans the amino acid sequence from region 1-364.

Product Specifications

Product Name Alternative

Medium-wave-sensitive opsin 1, Green cone photoreceptor pigment, Green-sensitive opsin, Medium wavelength-sensitive cone opsin

UniProt

O35478

Expression Region

1-364

Origin

Sciurus carolinensis (Gray squirrel)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQRWDPQRLAGGQPQDSHEDSTQSSIFTYTNSNATRGPFEGPNYHIAPRWVYHITSTWM IIVVIASVFTNGLVLVATMKFKKLRHPLNWILVNLAIADLAETVIASTISVVNQLYGYFV LGHPLCVVEGYTVSVCGITGLWSLAIISWERWLVVCKPFGNMRFDAKLAIVGIAFSWIWS AVWTAPPIFGWSRYWPYGLKTSCGPDVFSGTSYPGVQSYMMVLMVTCCIIPLSIIILCYL QVWLAIRAVAKQQKESESTQKAEKEVTRMVVVMVFAYCLCWGPYTFFACFATANPGYAFH PLVAALPAYFAKSATIYNPIIYVFMNRQFRNCILQLFGKKVDDTSELSSASKTEASSVSS VSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Cbp/p300 interacting transactivator 2 (CITED2) ELISA Kit
GTR10333420 96 Well

Rabbit Cbp/p300 interacting transactivator 2 (CITED2) ELISA Kit

Sign In for Pricing
View Details
Ammonium Pentaborate Tetrahydrate AR
457490-01 50 Kg

Ammonium Pentaborate Tetrahydrate AR

Sign In for Pricing
View Details
Ammonium Pentaborate Tetrahydrate AR
457490-02 500 g

Ammonium Pentaborate Tetrahydrate AR

Sign In for Pricing
View Details
ZNF100 (Zinc Finger Protein 100)
496163 100 µL

ZNF100 (Zinc Finger Protein 100)

Sign In for Pricing
View Details
TPA (Plasminogen Activator (Tissue) Monkey ELISA Kit
H6837 96 Tests

TPA (Plasminogen Activator (Tissue) Monkey ELISA Kit

Sign In for Pricing
View Details
(4-Dimethylaminophenyl) di-tert-butylphosphine
274606-01 500 mg

(4-Dimethylaminophenyl) di-tert-butylphosphine

Sign In for Pricing
View Details