Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class epsilon-21 (sre-21)

This Recombinant Serpentine receptor class epsilon-21 (sre-21) spans the amino acid sequence from region 1-365.

Product Specifications

Product Name Alternative

Serpentine receptor class epsilon-21, Protein sre-21

UniProt

O45306

Expression Region

1-365

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNFQFLAIFSVRLATKEEVLDRTQESGDVNVVWVFTYNSNREFSVFEFILINFLFLLSIF VTFIGVFCIGKSNIPHRNARWIIISGMLLWLELVVSRSFVFIFQWSSDGLQSRSGLLFWA ALLRYHYMFFGVHTLLCITAERAMATILLKDYETRPRVWIAAILIGANFLISLTYAFLAV FQQILMKSIFIVCLAVAVVSIILLEIIYFLNRKRLDSLIRHDNTMVLYTLSIKYQLQENV RSCRLMRPAVVVVGAFIIMLILAECLPIILDFSDEVQMWCNLIFDTTVHTDPLVVVPTVV ALMESFRKVFLSYYRTLQHKIRPNTVAVIRRKSIFPFTKPKETEGDIYFEMFNKSVSPNS LAVKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse PIIINP protein (GST tag)
PDEM100260-01 20 µg

Recombinant Mouse PIIINP protein (GST tag)

Sign In for Pricing
View Details
Recombinant Mouse PIIINP protein (GST tag)
PDEM100260-02 100 µg

Recombinant Mouse PIIINP protein (GST tag)

Sign In for Pricing
View Details
Recombinant Mouse PIIINP protein (GST tag)
PDEM100260-03 500 µg

Recombinant Mouse PIIINP protein (GST tag)

Sign In for Pricing
View Details
Recombinant Mouse PIIINP protein (GST tag)
PDEM100260-04 1 mg

Recombinant Mouse PIIINP protein (GST tag)

Sign In for Pricing
View Details
CEACAM19 (NM_001127893) Human Over-expression Lysate
LY426880 100 µg

CEACAM19 (NM_001127893) Human Over-expression Lysate

Sign In for Pricing
View Details
Freeze Dryer BFFT-308-A
BFFT-308-A 1 Unit

Freeze Dryer BFFT-308-A

Sign In for Pricing
View Details