Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class epsilon-21 (sre-21)

This Recombinant Serpentine receptor class epsilon-21 (sre-21) spans the amino acid sequence from region 1-365.

Product Specifications

Product Name Alternative

Serpentine receptor class epsilon-21, Protein sre-21

UniProt

O45306

Expression Region

1-365

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNFQFLAIFSVRLATKEEVLDRTQESGDVNVVWVFTYNSNREFSVFEFILINFLFLLSIF VTFIGVFCIGKSNIPHRNARWIIISGMLLWLELVVSRSFVFIFQWSSDGLQSRSGLLFWA ALLRYHYMFFGVHTLLCITAERAMATILLKDYETRPRVWIAAILIGANFLISLTYAFLAV FQQILMKSIFIVCLAVAVVSIILLEIIYFLNRKRLDSLIRHDNTMVLYTLSIKYQLQENV RSCRLMRPAVVVVGAFIIMLILAECLPIILDFSDEVQMWCNLIFDTTVHTDPLVVVPTVV ALMESFRKVFLSYYRTLQHKIRPNTVAVIRRKSIFPFTKPKETEGDIYFEMFNKSVSPNS LAVKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Potassium (Butoxycarbonothioyl)sulfide
TRC-P993585-500MG 500 mg

Potassium (Butoxycarbonothioyl)sulfide

Sign In for Pricing
View Details
Human Lambda Light Chain Mouse Monoclonal Antibody [Clone ID: LcN-2 + ICO-106]
AM33321PU-S 100 µg

Human Lambda Light Chain Mouse Monoclonal Antibody [Clone ID: LcN-2 + ICO-106]

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF740 conjugate, 0.1mg/mL
BNC742171-500 1x 500 µL

Human Kappa Light Chain (B-Cell Marker) (rKLC264), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Sphingomyelin Synthase 2 (SGMS2) (NM_001136257) Human Over-expression Lysate
LY427869 100 µg

Sphingomyelin Synthase 2 (SGMS2) (NM_001136257) Human Over-expression Lysate

Sign In for Pricing
View Details
CD36 Rabbit Polyclonal Antibody
ER1802-7 100 µL

CD36 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cell Meter™ Live Cell Caspase 3/7 Imaging Kit *Green Fluorescence*
20130-AAT 100 Tests

Cell Meter™ Live Cell Caspase 3/7 Imaging Kit *Green Fluorescence*

Sign In for Pricing
View Details