Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog C-X-C chemokine receptor type 3 (CXCR3)

This Recombinant Dog C-X-C chemokine receptor type 3 (CXCR3) spans the amino acid sequence from region 1-365.

Product Specifications

Product Name Alternative

C-X-C chemokine receptor type 3, CXC-R3, CXCR-3, Interferon-inducible protein 10 receptor, IP-10 receptor, CD_antigen= CD183

UniProt

Q5KSK8

Expression Region

1-365

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Immunology & Inflammation; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVPEMSERQVFQASELTYLLENCSSSYDYAENESDSCCASPPCPQDISLNFDRAFLPALY GLLFLLGLLGNGAVAAVLCSQRAARTSTDTFLLHLAVADMLLVLTLPLWRVDTAVQWVFG SGLCKVAGALFNINFYAGALLLACISFDRYLSIVHATQPYRRGPPARVTLTCVVVWGLCL FFAIPDFIFLSANRDERLNAMHCRYNFPQVGRTALRGLQLVAGFLLPLLVMAYCYARILA VLLVSRGQRRQRRMRLVVVVVVAFALCWTPYHLVVLVDTLMDLGALDRNCGRESRVDVAK SVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPDHRGHQRHPTLSRRESSWSET PSTPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL
BNC680017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF488A conjugate, 0.1mg/mL
BNC880175-500 1x 500 µL

CD46 (122.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF640R conjugate, 0.1mg/mL
BNC400305-500 1x 500 µL

CD95 (B-R18), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL
BNC700391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF594 conjugate, 0.1mg/mL
BNC940151-100 1x 100 µL

CD11a (Cris-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (C68/2501), CF640R conjugate, 0.1mg/mL
BNC402501-100 1x 100 µL

CD68 (Macrophage Marker) (C68/2501), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details