Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 142 (Gpr142)

This Recombinant Mouse Probable G-protein coupled receptor 142 (Gpr142) spans the amino acid sequence from region 1-365.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 142

UniProt

Q7TQN9

Expression Region

1-365

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHLNSNPNSYICDAYQHADLLWSLSPHVLTKAVQPQVTLLPTVNGSNPRYDGVDGHWPES PERSPCVAGIIPVIYYSVLLSLGLPVALARLAARTRKPSYHYLLALTASDIVTQVIIVFV GFLLQGAVLARQVPQAVVRTANILEFAANHASVWIAVLFTVDRYNALCRPLRHRATSSPG RTHRAIAAVIGVTLLTGIPFYWWLDVWRDADPPSTMDKLLKWAHCLIVYFIPCNVFLVTN SAIILRLRKRGQRGLRPLVSKSTAILLGVTSLFALLWAPRIIVMLYHLYVAPVHRDWRVH LALDIANMLAMLNTEVNFGLYCFISKTFRATVRQVICDVHMACALKSQPKQTVVELMLKS VGTEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAALADL1 Human Gene Knockout Kit (CRISPR)
KN417792 1 Kit

NAALADL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant DNA Ligase I Antibody
RC-5780-01 50 μL

Recombinant DNA Ligase I Antibody

Sign In for Pricing
View Details
Recombinant DNA Ligase I Antibody
RC-5780-02 100 µL

Recombinant DNA Ligase I Antibody

Sign In for Pricing
View Details
Recombinant DNA Ligase I Antibody
RC-5780-03 1 mL

Recombinant DNA Ligase I Antibody

Sign In for Pricing
View Details
SDR O (SDR9C7) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6A8]
TA501706BM 100 µL

SDR O (SDR9C7) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6A8]

Sign In for Pricing
View Details
BactoViewTM Dead 655/670
#40111 1x 100 µL

BactoViewTM Dead 655/670

Sign In for Pricing
View Details