Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 142 (Gpr142)

This Recombinant Mouse Probable G-protein coupled receptor 142 (Gpr142) spans the amino acid sequence from region 1-365.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 142

UniProt

Q7TQN9

Expression Region

1-365

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHLNSNPNSYICDAYQHADLLWSLSPHVLTKAVQPQVTLLPTVNGSNPRYDGVDGHWPES PERSPCVAGIIPVIYYSVLLSLGLPVALARLAARTRKPSYHYLLALTASDIVTQVIIVFV GFLLQGAVLARQVPQAVVRTANILEFAANHASVWIAVLFTVDRYNALCRPLRHRATSSPG RTHRAIAAVIGVTLLTGIPFYWWLDVWRDADPPSTMDKLLKWAHCLIVYFIPCNVFLVTN SAIILRLRKRGQRGLRPLVSKSTAILLGVTSLFALLWAPRIIVMLYHLYVAPVHRDWRVH LALDIANMLAMLNTEVNFGLYCFISKTFRATVRQVICDVHMACALKSQPKQTVVELMLKS VGTEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin K (Marker of Tumor Invasiveness) (CTSK/2793), CF647 conjugate, 0.1mg/mL
BNC472793-500 1x 500 µL

Cathepsin K (Marker of Tumor Invasiveness) (CTSK/2793), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Neurovascular bundle
CS643733 5x 5 µm

Frozen Tissue Sections, Neurovascular bundle

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse CD4 Antibody[GK1.5]
E-AB-F1097US-01 25 µg

Elab Fluor® Red 780 Anti-Mouse CD4 Antibody[GK1.5]

Sign In for Pricing
View Details
Elab Fluor® Red 780 Anti-Mouse CD4 Antibody[GK1.5]
E-AB-F1097US-02 100 µg

Elab Fluor® Red 780 Anti-Mouse CD4 Antibody[GK1.5]

Sign In for Pricing
View Details
CEP104 Antibody
OC-2017-01 50 μL

CEP104 Antibody

Sign In for Pricing
View Details
CEP104 Antibody
OC-2017-02 100 µL

CEP104 Antibody

Sign In for Pricing
View Details