Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Guinea pig 5-hydroxytryptamine receptor 1E (5HT1E)

This Recombinant Guinea pig 5-hydroxytryptamine receptor 1E (5HT1E) spans the amino acid sequence from region 1-365.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1E, 5-HT-1E, 5-HT1E, Serotonin receptor 1E

UniProt

Q6VB83

Expression Region

1-365

Origin

Cavia porcellus (Guinea pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNITNCTTDASMVVRPKTVTEKMLICMTLVIITTLTMLLNSAVIMAICTTKKLHQPANYL ICSLAVTDLLVAVLVMPLSIMYIVMDSWRLGYFICEVWLSVDMTCCTCSILHLCVIALDR YWAITNAIEYARKRTAKRAGLMILTVWTISIFISMPPLFWRSHRQLSPPPSQCTIQHDHV IYTIYSTFGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQ TFCVSDFSTSDPTTEFEKIHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAF ILSWLPFFIKELIVGLSIYTVSSEVGDFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIR CREHT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cefmetazole Lactone (~90%)
TRC-C242855-1MG 1 mg

Cefmetazole Lactone (~90%)

Sign In for Pricing
View Details
CD19 Mouse Monoclonal Antibody (SJ25C1), R-PE Conjugate - Biotium Choice
P010-RPE-125 1x 125 µL

CD19 Mouse Monoclonal Antibody (SJ25C1), R-PE Conjugate - Biotium Choice

Sign In for Pricing
View Details
Tissue Total RNA, Endometriotic tissue
CR563049 5 µg

Tissue Total RNA, Endometriotic tissue

Sign In for Pricing
View Details
CD28 (C28/74), CF647 conjugate, 0.1mg/mL
BNC470074-100 1x 100 µL

CD28 (C28/74), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human VEGF-C/VEGFC Protein (His Tag)
PKSH031993-01 10 µg

Recombinant Human VEGF-C/VEGFC Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human VEGF-C/VEGFC Protein (His Tag)
PKSH031993-02 50 µg

Recombinant Human VEGF-C/VEGFC Protein (His Tag)

Sign In for Pricing
View Details