Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 4 (Gpr4)

This Recombinant Mouse G-protein coupled receptor 4 (Gpr4) spans the amino acid sequence from region 1-365.

Product Specifications

Product Name Alternative

G-protein coupled receptor 4

UniProt

Q8BUD0

Expression Region

1-365

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNSTGTGEGCHVDSRVDHLFPPSLYIFVIGVGLPTNCLALWAAYRQVRQHNELGVYLMN LSIADLLYICTLPLWVDYFLHHDNWIHGPGSCKLFGFIFYSNIYISIAFLCCISVDRYLA VAHPLRFARLRRVKTAVAVSSVVWATELGANSAPLFHDELFRDRYNHTFCFEKFPMERWV AWMNLYRVFVGFLFPWALMLLCYRGILRAVQSSVSTERQEKVKIKRLALSLIAIVLVCFA PYHALLLSRSAVYLGRPWDCGFEERVFSAYHSSLAFTSLNCVADPILYCLVNEGARSDVA KALHNLLRFLASNKPQEMANASLTLETPLTSKRSTTGKSSGAVWAVPPTAQGDQVPLKVL LPPAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human tumor necrosis factor receptor 1, TNF-R1 ELISA Kit
MBS167687-01 48 Well

Human tumor necrosis factor receptor 1, TNF-R1 ELISA Kit

Sign In for Pricing
View Details
Human tumor necrosis factor receptor 1, TNF-R1 ELISA Kit
MBS167687-02 96 Well

Human tumor necrosis factor receptor 1, TNF-R1 ELISA Kit

Sign In for Pricing
View Details
Human tumor necrosis factor receptor 1, TNF-R1 ELISA Kit
MBS167687-03 5x 96 Well

Human tumor necrosis factor receptor 1, TNF-R1 ELISA Kit

Sign In for Pricing
View Details
Human tumor necrosis factor receptor 1, TNF-R1 ELISA Kit
MBS167687-04 10x 96 Well

Human tumor necrosis factor receptor 1, TNF-R1 ELISA Kit

Sign In for Pricing
View Details
3-Chloro-1-propanol
FC38664 0.5 Kg

3-Chloro-1-propanol

Sign In for Pricing
View Details
Influenza A virus Neuraminidase/NA Human Monoclonal Antibody
orb2959353-01 50 µg

Influenza A virus Neuraminidase/NA Human Monoclonal Antibody

Sign In for Pricing
View Details