Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse G-protein coupled receptor 4 (Gpr4)

This Recombinant Mouse G-protein coupled receptor 4 (Gpr4) spans the amino acid sequence from region 1-365.

Product Specifications

Product Name Alternative

G-protein coupled receptor 4

UniProt

Q8BUD0

Expression Region

1-365

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDNSTGTGEGCHVDSRVDHLFPPSLYIFVIGVGLPTNCLALWAAYRQVRQHNELGVYLMN LSIADLLYICTLPLWVDYFLHHDNWIHGPGSCKLFGFIFYSNIYISIAFLCCISVDRYLA VAHPLRFARLRRVKTAVAVSSVVWATELGANSAPLFHDELFRDRYNHTFCFEKFPMERWV AWMNLYRVFVGFLFPWALMLLCYRGILRAVQSSVSTERQEKVKIKRLALSLIAIVLVCFA PYHALLLSRSAVYLGRPWDCGFEERVFSAYHSSLAFTSLNCVADPILYCLVNEGARSDVA KALHNLLRFLASNKPQEMANASLTLETPLTSKRSTTGKSSGAVWAVPPTAQGDQVPLKVL LPPAQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Treponema Pallidum hisS Protein (aa 1-442)
VAng-Cr1537-50gEcoli 50 µg (E. coli)

Recombinant Treponema Pallidum hisS Protein (aa 1-442)

Sign In for Pricing
View Details
ATF6B antibody
70R-32095 0.1 mg

ATF6B antibody

Sign In for Pricing
View Details
Clec1b antibody - N-terminal region (ARP47260_P050)
ARP47260_P050 100 µL

Clec1b antibody - N-terminal region (ARP47260_P050)

Sign In for Pricing
View Details
SNF2L Polyclonal Antibody, APC-Cy7 Conjugated
bs-6015R-APC-Cy7 100 µL

SNF2L Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal Carboxypeptidase A2 (CPA2) Antibody (Human, Mouse, Rat)
B2022407 100 µL

Mouse Monoclonal Carboxypeptidase A2 (CPA2) Antibody (Human, Mouse, Rat)

Sign In for Pricing
View Details
PLCG 2 Recombinant Antibody, Cy3 Conjugated
bsm-62254R-Cy3 100 µL

PLCG 2 Recombinant Antibody, Cy3 Conjugated

Sign In for Pricing
View Details