Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes 5-hydroxytryptamine receptor 1F (HTR1F)

This Recombinant Pan troglodytes 5-hydroxytryptamine receptor 1F (HTR1F) spans the amino acid sequence from region 1-365.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1F, 5-HT-1F, 5-HT1F, Serotonin receptor 1F

UniProt

Q9N2D9

Expression Region

1-365

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANY LICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALD RYRAITDAVEYARKRTPKHAGIMITIVWIISVFISMPPLFWRHQGTSRDDECIIKHBHIV STIYSTFGAFYIPLALILILYYKIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKS VSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWRRQKISGTRERKAATTLGLILG AFVICWLPFFVKELVVNVCDKCKISEEMSNFLAWLGYLNSLINPLIYTIFNEDFKKAFQK LVRCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse CD45 (I3/2.3) In Vivo Antibody - Low Endotoxin
ICH1057-25mg 25 mg

Anti-Mouse CD45 (I3/2.3) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Human ZNF395 activation kit by CRISPRa
GA111044 1 Kit

Human ZNF395 activation kit by CRISPRa

Sign In for Pricing
View Details
RMND5A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C6]
TA803292AM 100 µL

RMND5A Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2C6]

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS714435 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
alpha 1a Adrenergic Receptor (ADRA1A) Rabbit Polyclonal Antibody
AP06787PU-N 100 µg

alpha 1a Adrenergic Receptor (ADRA1A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD9 Recombinant Monoclonal Mouse Antibody (2310.9), CF®700 Conjugate - Biotium Choice
P015-700-125 1x 125 µL

CD9 Recombinant Monoclonal Mouse Antibody (2310.9), CF®700 Conjugate - Biotium Choice

Sign In for Pricing
View Details