Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes 5-hydroxytryptamine receptor 1F (HTR1F)

This Recombinant Pan troglodytes 5-hydroxytryptamine receptor 1F (HTR1F) spans the amino acid sequence from region 1-365.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1F, 5-HT-1F, 5-HT1F, Serotonin receptor 1F

UniProt

Q9N2D9

Expression Region

1-365

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANY LICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALD RYRAITDAVEYARKRTPKHAGIMITIVWIISVFISMPPLFWRHQGTSRDDECIIKHBHIV STIYSTFGAFYIPLALILILYYKIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKS VSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWRRQKISGTRERKAATTLGLILG AFVICWLPFFVKELVVNVCDKCKISEEMSNFLAWLGYLNSLINPLIYTIFNEDFKKAFQK LVRCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rbm46 Mouse Gene Knockout Kit (CRISPR)
KN514575 1 Kit

Rbm46 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
OR2G6 (NM_001013355) Human Over-expression Lysate
LY422962 100 µg

OR2G6 (NM_001013355) Human Over-expression Lysate

Sign In for Pricing
View Details
SPATA31A2 Human Gene Knockout Kit (CRISPR)
KN422928 1 Kit

SPATA31A2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CHOX_ALCSP Goat Polyclonal Antibody
TA396685S 25 µL

CHOX_ALCSP Goat Polyclonal Antibody

Sign In for Pricing
View Details
PAX8 (NM_013953) Human Recombinant Protein
TP314188 20 µg

PAX8 (NM_013953) Human Recombinant Protein

Sign In for Pricing
View Details
Tbx18 Mouse Gene Knockout Kit (CRISPR)
KN517286 1 Kit

Tbx18 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details