Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes 5-hydroxytryptamine receptor 1F (HTR1F)

This Recombinant Pan troglodytes 5-hydroxytryptamine receptor 1F (HTR1F) spans the amino acid sequence from region 1-365.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1F, 5-HT-1F, 5-HT1F, Serotonin receptor 1F

UniProt

Q9N2D9

Expression Region

1-365

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANY LICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALD RYRAITDAVEYARKRTPKHAGIMITIVWIISVFISMPPLFWRHQGTSRDDECIIKHBHIV STIYSTFGAFYIPLALILILYYKIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKS VSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWRRQKISGTRERKAATTLGLILG AFVICWLPFFVKELVVNVCDKCKISEEMSNFLAWLGYLNSLINPLIYTIFNEDFKKAFQK LVRCR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cbln1 activation kit by CRISPRa
GA200562 1 Kit

Mouse Cbln1 activation kit by CRISPRa

Sign In for Pricing
View Details
SULT2A1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4D7]
TA501694AM 100 µL

SULT2A1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4D7]

Sign In for Pricing
View Details
FUSIP1 (SRSF10) (NM_006625) Human Recombinant Protein
TP321759 20 µg

FUSIP1 (SRSF10) (NM_006625) Human Recombinant Protein

Sign In for Pricing
View Details
Orbital Shaker BSOT-603
BSOT-603 Each

Orbital Shaker BSOT-603

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human IgG2 GOM1,  15nm
GM-202-15 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgG2 GOM1, 15nm

Sign In for Pricing
View Details
TEKT2 Mouse Monoclonal Antibody [Clone ID: OTI1E11]
CF809970 100 µg

TEKT2 Mouse Monoclonal Antibody [Clone ID: OTI1E11]

Sign In for Pricing
View Details