Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Pheromone M-factor receptor (map3)

This Recombinant Schizosaccharomyces pombe Pheromone M-factor receptor (map3) spans the amino acid sequence from region 1-365.

Product Specifications

Product Name Alternative

Pheromone M-factor receptor

UniProt

P31397

Expression Region

1-365

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLPIGIFYQFYAYFALVLSIPILYMQLRARNIPCLLLLFWLTLTTLIYVVESAIWSNPYA ETIRWMGYGLCDITSRIVTCSSIGIPASAFTLVLYLDTVIRRDHPLKRYENWIWHVCLSI LLPLIIMAMMVPLESNRYVVICMNGCYSSFYQTWYTLLFFYIPPCLLSFGGLFFVSRIVV LYWRRQRELQQFFQRDSQLTSKRFLRLLCLAAVFFLGYFPLTIFMVVANGKLQQFLPFNH ELVEAWHQESITYYPTTKVGLNDWVPPTVLYLMSLFFSTSGGWTEKVALILWSLLVWLPF TKNTALGRHAQFKLDCCKSIESTMAGKTLDSTDFKEKCLVLERQWSKSSIPSDNSSELQD AAKYV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Zdhhc3 qPCR Primer Pair
QM37078S 200 Tests

Mouse Zdhhc3 qPCR Primer Pair

Sign In for Pricing
View Details
Goat anti Mouse IgG1
MBS534827-01 1 mg

Goat anti Mouse IgG1

Sign In for Pricing
View Details
Goat anti Mouse IgG1
MBS534827-02 5x 1 mg

Goat anti Mouse IgG1

Sign In for Pricing
View Details
VPAC2 Antibody
G790-01 50 μL

VPAC2 Antibody

Sign In for Pricing
View Details
VPAC2 Antibody
G790-02 100 µL

VPAC2 Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Cat IgG, Fc Specific,  40nm
GAF-422-40 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Cat IgG, Fc Specific, 40nm

Sign In for Pricing
View Details