Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio G-protein coupled receptor 183-B (gpr183b)

This Recombinant Danio rerio G-protein coupled receptor 183-B (gpr183b) spans the amino acid sequence from region 1-366.

Product Specifications

Product Name Alternative

G-protein coupled receptor 183-B

UniProt

B0UXR0

Expression Region

1-366

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMSPDLDLNFSSNCNLYDHRPVARVLIPLVYSIICPVGLLGNALALHVVISSTTKINSIT LYSANLAVSDILFCLSLPLRAVYYGLGFHWPMGEVLCKAIALLFYLNCYAGVNFMTCLAV DRFVALVFPARLAKLRKAKNVRFVCLAIWLLVLAQTLPLLTIGLTKTEPDSSITCMEYPN FEGVFKGLPYMLIVAVVLGFGIPVMTIIACYSILTHKLHQAAKSNQLTERSGKTKKARGV IAGVVFVFVVCFSPYHIDILQYMIRKLLYETDCKELQSFQISLHITVCLMNLNSCLDPFV YFFACKGYKQKVMRMMKWQVGTHFSSVKNSAESSGTGDVLGTRRNNRIIMNNVGEDQQIC YQPSAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
BNC740178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF640R conjugate, 0.1mg/mL
BNC400189-500 1x 500 µL

CD74 (BU45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL
BNC940034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF488A conjugate, 0.1mg/mL
BNC880160-500 1x 500 µL

CD20 (B9E9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL
BNC400034-500 1x 500 µL

Cytokeratin 8/18 (C-51), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF594 conjugate, 0.1mg/mL
BNC940345-100 1x 100 µL

CD4 (EDU-2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details