Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class epsilon-6 (sre-6)

This Recombinant Serpentine receptor class epsilon-6 (sre-6) spans the amino acid sequence from region 1-366.

Product Specifications

Product Name Alternative

Serpentine receptor class epsilon-6, Protein sre-6

UniProt

Q19897

Expression Region

1-366

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSSSEYRFLTYINGTVVDYIEWRLPLQFIYSFEVGMMVTNFLEYVYTFYLLLRFRAMHS NLHILLLLYGGQYFFSMISRAVLLYFQFHDAESMNDPSFADLIYTANYTRTICLFVAFNM LPFLVFERCFATCFAGTYENDRHYWIPLLLISIMMPVCVFSAVAYINNWFSIYTHGILLI VLNIGGSLLLIIVTKCNIRLHNSYSTLEHHGLYSLSERFQVSENIKTCQWLSRIQGSILF FNVACVSLLVLENVSMNDKMVIVSNVSFNILCTIYAAVTPIIVIIYTPEWTRETIRLWHL IFLLSNTDQLDLRTTFGEEMNYSDKNIESKVYFDQLQRNLTEEAMKKSKKKHRSSSWNNS EHEIFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTCO1 Recombinant Rabbit monoclonal Antibody
HA751171 100 µL

MTCO1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Securin (PTTG1) Rabbit Monoclonal Antibody [Clone ID: R09-6J7]
TA385096 100 µL

Securin (PTTG1) Rabbit Monoclonal Antibody [Clone ID: R09-6J7]

Sign In for Pricing
View Details
Tissue FFPE Sections, Soft tissue
CS714356 5x 5 µm

Tissue FFPE Sections, Soft tissue

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (UCHL1/841), CF647 conjugate, 0.1mg/mL
BNC470841-100 1x 100 µL

Pgp9.5 (UCHL-1) (UCHL1/841), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H2B (Acetyl-Lys15) Antibody
8D0005-AAT 50 µg

Histone H2B (Acetyl-Lys15) Antibody

Sign In for Pricing
View Details
ALDH1A1/2/3 Polyclonal Antibody
E-AB-13801-01 20 µL

ALDH1A1/2/3 Polyclonal Antibody

Sign In for Pricing
View Details