Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Protein lifeguard 1 (GRINA)

This Recombinant Bovine Protein lifeguard 1 (GRINA) spans the amino acid sequence from region 1-366.

Product Specifications

Product Name Alternative

Protein lifeguard 1, Glutamate [NMDA] receptor-associated protein 1, NMDA receptor glutamate-binding subunit

UniProt

Q32L53

Expression Region

1-366

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSHEKSFLVSGDSYPPPNPGYPGGPQPSMAPYPGAPYPQAPFQPSPYGQPGYPQGPSPYP QGGYPQGPYPPGGYPQGPYPPGGYPQGPYPPGGYPQGPYPQSPFPPNPYGQPQAFPAQDP GSPHHGNYHEEGPPSYYDNQDFPATNWDDKSIRQAFIRKVFLVLTLQLSVTLSTVAVFTF VGEVKGFVRENVWTYYVSYAIFFVSLIVLSCCGDFRRKHPWNLVALSILTVSLSYMVGMI ASFYNTEAVIMAVGITTTVCFTVVIFSMQTRYDFTSCVGVLLVSVVVLILFAILCIFIRS RVLEIVYASLGALLFTCFLAVDTQLLLGNKQLSLSPEEYVFAALNLYTDIINIFLYILTI IGRAKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL
BNC400342-100 1x 100 µL

CD43 (84-3C1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL
BNC470096-100 1x 100 µL

Histone H1 (AE-4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL
BNC742848-500 1x 500 µL

Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
BNC680304-500 1x 500 µL

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL
BNC040218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (MUC18/1130), CF740 conjugate, 0.1mg/mL
BNC741130-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (MUC18/1130), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details