Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Goat C-X-C chemokine receptor type 3 (CXCR3)

This Recombinant Goat C-X-C chemokine receptor type 3 (CXCR3) spans the amino acid sequence from region 1-366.

Product Specifications

Product Name Alternative

C-X-C chemokine receptor type 3, CXC-R3, CXCR-3, Interferon-inducible protein 10 receptor, IP-10 receptor, CD_antigen= CD183

UniProt

Q867B2

Expression Region

1-366

Origin

Capra hircus (Goat)

Field of Research

Immunology & Inflammation; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVPEMSERQEFQASEFAYLLENSSYDYGENETYFCCTSPPCPQDFSLNFDRTFLPVLYSL LFVLGLLGNGVVAVVLLSQRAALSSTDTFLLHLAVADALLVLTLPLWAVDAAIQWVFGSG LCKVAGALFNINFYAGALLLACISFDRYLSIVHATQFYRRGPPARVALTCVAVWGLCLLF ALPDFIFLSSHHDNRLNATHCQYNFPQEGRTALRVLQLVAGFLLPLLVMAYCYARILTVL LVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDTLMDLGALARNCGRESRVDVAKSV TSGMGYMHCCLNPLLYAFVGVKFRERMWVLLMRLGCPDQRGHQRQPSASRRDSSWSETTE ASYSGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL
BNC941820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL
BNC400029-100 1x 100 µL

Fibronectin (TV-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF660R conjugate, 0.1mg/mL
BNC610164-100 1x 100 µL

CD28 (204.12), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL
BNC000437-500 1x 500 µL

CD47 (B6H12.2), CF700 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL
BNC400040-500 1x 500 µL

CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL
BNC940096-500 1x 500 µL

Histone H1 (AE-4), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details