Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Lysophosphatidic acid receptor 1-B (lpar1-b)

This Recombinant Xenopus laevis Lysophosphatidic acid receptor 1-B (lpar1-b) spans the amino acid sequence from region 1-366.

Product Specifications

Product Name Alternative

Lysophosphatidic acid receptor 1-B, LPA receptor 1-B, LPA-1-B, Lysophosphatidic acid receptor LPA1 homolog 2, xLPA1-2

UniProt

Q9PU16

Expression Region

1-366

Origin

Xenopus laevis (African clawed frog)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTSLSEFVSEPIGMMSQTSAASESQCYYNETIAFFYNRSGKYLDTEWNAVSKLVMGLGIT VCIFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTV STWLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTVAIVM GAIPSVGWNCICDLEHCSNMAPLYSDSYLIFWTIFNLVTFVVMVVLYAHIFVYVRQRTMR MSRHSSGPRRNRDTMMSLLKTVVIVLGAFIVCWTPGLVLLLLDVCCPQCNILAYEKFFLL LAEFNSAMNPIIYSYRDKEMSATFKQILCCQRTENVNGPTEGSDRSASSLNHTILAGVHS NDHSVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL
BNC940146-100 1x 100 µL

CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL
BNC470034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL
BNC400270-100 1x 100 µL

Fibronectin (HFN7.1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL
BNC740225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF488A conjugate, 0.1mg/mL
BNC880630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF594 conjugate, 0.1mg/mL
BNC940226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details