Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat 5-hydroxytryptamine receptor 1F (Htr1f)

This Recombinant Rat 5-hydroxytryptamine receptor 1F (Htr1f) spans the amino acid sequence from region 1-366.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1F, 5-HT-1F, 5-HT1F, Serotonin receptor 1F

UniProt

P30940

Expression Region

1-366

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINCLVITAIIVTRKLHHPANY LICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQGLCDLWLSVDIICCTCSILHLSAIALD RYRAITDAVEYARKRTPRHAGITITTVWVISVFISVPPLFWRHQGNSRDDQCIIKHDHIV STIYSTFGAFYIPLVLILILYYKIYRAARTLYHKRQASRMIKEELNGQVLLESGEKSIKL VSTSYMLEKSLSDPSTDFDRIHSTVKSPRSELKHEKSWRRQKISGTRERKAATTLGLILG AFVICWLPFFVKELVVNICEKCKISEEMSNFLAWLGYLNSLINPLIYTIFNEDFKKAFQK LVRCRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUSTN1 (NM_205853) Human Over-expression Lysate
LC404202 20 µg

MUSTN1 (NM_205853) Human Over-expression Lysate

Sign In for Pricing
View Details
ViaTagTM 740/765 Haloalkane Ligand, 1000X in DMSO
#10311 1x 30 µL

ViaTagTM 740/765 Haloalkane Ligand, 1000X in DMSO

Sign In for Pricing
View Details
CD34 (QBEnd/10), 0.2mg/mL
BNUB0640-100 1x 100 µL

CD34 (QBEnd/10), 0.2mg/mL

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD19 Antibody[SJ25C1]
AN00334H-01 20 Tests

PE/Cyanine7 Anti-Human CD19 Antibody[SJ25C1]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD19 Antibody[SJ25C1]
AN00334H-02 100 Tests

PE/Cyanine7 Anti-Human CD19 Antibody[SJ25C1]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human CD19 Antibody[SJ25C1]
AN00334H-03 2x 100 Tests

PE/Cyanine7 Anti-Human CD19 Antibody[SJ25C1]

Sign In for Pricing
View Details