Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Guinea pig 5-hydroxytryptamine receptor 1F (HTR1F)

This Recombinant Guinea pig 5-hydroxytryptamine receptor 1F (HTR1F) spans the amino acid sequence from region 1-366.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1F, 5-HT-1F, 5-HT1F, Serotonin receptor 1F

UniProt

O08890

Expression Region

1-366

Origin

Cavia porcellus (Guinea pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDFLNSSDQNLTSEELLHRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANY LICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVLCDIWLSVDIICCTCSILHLSAIALD RYRAITDAVEYARKRTPKQAGIMITIVWIISVFISMPPLFWRHQGTSRDDECIIKHDHIV STIYSTFGAFYIPLVLILILYYKIYKAAKTLYHKRQASRIAKEELNGQVLLESGEKSIKM VSTTYVPEKSLSDPSTDFDKIHNTVKSPRCKLRHEKSWRRQKISGTRERKAATTLGLILG AFVICWLPFFVKELVVNVCEKCKISEEMANFLAWLGYLNSLINPLIYTIFNEDFKKAFQK LVRCQY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Bcl2L11 (Bcl-2 Like Protein 11) ELISA Kit
RE1323H-01 48 Tests

Human Bcl2L11 (Bcl-2 Like Protein 11) ELISA Kit

Sign In for Pricing
View Details
Human Bcl2L11 (Bcl-2 Like Protein 11) ELISA Kit
RE1323H-02 96 Tests

Human Bcl2L11 (Bcl-2 Like Protein 11) ELISA Kit

Sign In for Pricing
View Details
MATN1 Conjugated Antibody
orb1621075 100 µL

MATN1 Conjugated Antibody

Sign In for Pricing
View Details
Recombinant Human Probable global transcription activator SNF2L2 (SMARCA2) , partial
CSB-MP021799HU4-01 20 µg

Recombinant Human Probable global transcription activator SNF2L2 (SMARCA2) , partial

Sign In for Pricing
View Details
Recombinant Human Probable global transcription activator SNF2L2 (SMARCA2) , partial
CSB-MP021799HU4-02 100 µg

Recombinant Human Probable global transcription activator SNF2L2 (SMARCA2) , partial

Sign In for Pricing
View Details
Recombinant Human Probable global transcription activator SNF2L2 (SMARCA2) , partial
CSB-MP021799HU4-03 1 mg

Recombinant Human Probable global transcription activator SNF2L2 (SMARCA2) , partial

Sign In for Pricing
View Details