Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit B2 bradykinin receptor (BDKRB2)

This Recombinant Rabbit B2 bradykinin receptor (BDKRB2) spans the amino acid sequence from region 1-367.

Product Specifications

Product Name Alternative

B2 bradykinin receptor, B2R, BK-2 receptor

UniProt

Q28642

Expression Region

1-367

Origin

Oryctolagus cuniculus (Rabbit)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLNITSQVLAPALNGSVSQSSGCPNTEWSGWLNVIQAPFLWVLFVLATLENLFVLSVFCL HKSSCTVAEVYLGNLAAADLILACGLPFWAVTIANHFDWLFGEALCRVVNTMIYMNLYSS ICFLMLVSIDRYLALVKTMSIGRMRRVRWAKLYSLVIWGCTLLLSSPMLVFRTMKDYRDE GYNVTACIIDYPSRSWEVFTNVLLNLVGFLLPLSVITFCTVQILQVLRNNEMQKFKEIQT ERRATVLVLAVLLLFVVCWLPFQVSTFLDTLLKLGVLSSCWDEHVIDVITQVGSFMGYSN SCLNPLVYVIVGKRFRKKSREVYRAACPKAGCVLEPVQAESSMGTLRTSISVERQIHKLP EWTRSSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Griffonia simplicifolia Lectin -GS-I-A4 -,  30nm
GP-2401-A-30 1 mL

Colloidal Gold Conjugated Griffonia simplicifolia Lectin -GS-I-A4 -, 30nm

Sign In for Pricing
View Details
ANGPT1 Polyclonal Antibody
E-AB-10133-01 20 µL

ANGPT1 Polyclonal Antibody

Sign In for Pricing
View Details
ANGPT1 Polyclonal Antibody
E-AB-10133-02 60 µL

ANGPT1 Polyclonal Antibody

Sign In for Pricing
View Details
ANGPT1 Polyclonal Antibody
E-AB-10133-03 120 µL

ANGPT1 Polyclonal Antibody

Sign In for Pricing
View Details
ANGPT1 Polyclonal Antibody
E-AB-10133-04 200 µL

ANGPT1 Polyclonal Antibody

Sign In for Pricing
View Details
Uncoated Mouse IL-17C (Interleukin 17C) ELISA Kit
E-UNEL-M0199-01 5x 96 Tests

Uncoated Mouse IL-17C (Interleukin 17C) ELISA Kit

Sign In for Pricing
View Details