Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit B2 bradykinin receptor (BDKRB2)

This Recombinant Rabbit B2 bradykinin receptor (BDKRB2) spans the amino acid sequence from region 1-367.

Product Specifications

Product Name Alternative

B2 bradykinin receptor, B2R, BK-2 receptor

UniProt

Q28642

Expression Region

1-367

Origin

Oryctolagus cuniculus (Rabbit)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLNITSQVLAPALNGSVSQSSGCPNTEWSGWLNVIQAPFLWVLFVLATLENLFVLSVFCL HKSSCTVAEVYLGNLAAADLILACGLPFWAVTIANHFDWLFGEALCRVVNTMIYMNLYSS ICFLMLVSIDRYLALVKTMSIGRMRRVRWAKLYSLVIWGCTLLLSSPMLVFRTMKDYRDE GYNVTACIIDYPSRSWEVFTNVLLNLVGFLLPLSVITFCTVQILQVLRNNEMQKFKEIQT ERRATVLVLAVLLLFVVCWLPFQVSTFLDTLLKLGVLSSCWDEHVIDVITQVGSFMGYSN SCLNPLVYVIVGKRFRKKSREVYRAACPKAGCVLEPVQAESSMGTLRTSISVERQIHKLP EWTRSSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Thyroid gland
CS514599 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
RPL22L1 (NM_001099645) Human Over-expression Lysate
LY420471 100 µg

RPL22L1 (NM_001099645) Human Over-expression Lysate

Sign In for Pricing
View Details
Human LSM2 activation kit by CRISPRa
GA111736 1 Kit

Human LSM2 activation kit by CRISPRa

Sign In for Pricing
View Details
OXGR1 Rabbit Monoclonal Antibody [Clone ID: 23GB4575]
TA425028 100 µL

OXGR1 Rabbit Monoclonal Antibody [Clone ID: 23GB4575]

Sign In for Pricing
View Details
ERCC1 Mouse Monoclonal Antibody [Clone ID: OTI5E2]
CF805666 100 µg

ERCC1 Mouse Monoclonal Antibody [Clone ID: OTI5E2]

Sign In for Pricing
View Details
FCRLB Mouse Monoclonal Antibody [Clone ID: OTI4C4]
CF809250 100 µg

FCRLB Mouse Monoclonal Antibody [Clone ID: OTI4C4]

Sign In for Pricing
View Details