Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig B2 bradykinin receptor (BDKRB2)

This Recombinant Pig B2 bradykinin receptor (BDKRB2) spans the amino acid sequence from region 1-367.

Product Specifications

Product Name Alternative

B2 bradykinin receptor, B2R, BK-2 receptor

UniProt

Q9GLX8

Expression Region

1-367

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLNLTSQVPEPALNGTLPQSSSCFHSDWWNWLNTIQAPFLWVLFLLAALENIFVLSVFCL HKNSCTVAEIYLGNLAMADLILALGLPFWAITIANHFDWLFGEVLCRVVNTMIYMNLYSS ICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLVIWGCTLLLSSPMLAFRTMHEYAAE GHNVTACIIKYPSRSWMVFTNILLNSVGFLLPLSIITYCTVQILQVLRNNEMQKFKEIQT ERKATVLVLAVLLLFVVCWLPFQISTFLDTLLRLGVLSGCWDEHAVDVITQISSYVAYSN SGLNPLVYVIVGKRFRKKSREVYRVLCQKGGCMGEPVQMENSMGTLRTSISVERQIHKLQ DWAGKKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC39A6 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
44188156 3x 1.0 µg DNA

SLC39A6 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Mmu-miR-370-3p miRNA Inhibitor
orb1870708-01 10 nmol

Mmu-miR-370-3p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-370-3p miRNA Inhibitor
orb1870708-02 20 nmol

Mmu-miR-370-3p miRNA Inhibitor

Sign In for Pricing
View Details
USP8, CT (Ubiquitin Carboxyl-terminal Hydrolase 8, Ubiquitin Thiolesterase 8, Ubiquitin-specific processing Protease 8, Deubiquitinating Enzyme 8, Ubiquitin Isopeptidase Y, hUBPy, KIAA0055, UBPY) (MaxLight 405)
MBS6505076-01 0.1 mL

USP8, CT (Ubiquitin Carboxyl-terminal Hydrolase 8, Ubiquitin Thiolesterase 8, Ubiquitin-specific processing Protease 8, Deubiquitinating Enzyme 8, Ubiquitin Isopeptidase Y, hUBPy, KIAA0055, UBPY) (MaxLight 405)

Sign In for Pricing
View Details
USP8, CT (Ubiquitin Carboxyl-terminal Hydrolase 8, Ubiquitin Thiolesterase 8, Ubiquitin-specific processing Protease 8, Deubiquitinating Enzyme 8, Ubiquitin Isopeptidase Y, hUBPy, KIAA0055, UBPY) (MaxLight 405)
MBS6505076-02 5x 0.1 mL

USP8, CT (Ubiquitin Carboxyl-terminal Hydrolase 8, Ubiquitin Thiolesterase 8, Ubiquitin-specific processing Protease 8, Deubiquitinating Enzyme 8, Ubiquitin Isopeptidase Y, hUBPy, KIAA0055, UBPY) (MaxLight 405)

Sign In for Pricing
View Details
Human MAOB (Amine oxidase [flavin-containing] B) ELISA Kit
EKF57516 96 Tests

Human MAOB (Amine oxidase [flavin-containing] B) ELISA Kit

Sign In for Pricing
View Details