Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Nociceptin receptor (Oprl1)

This Recombinant Mouse Nociceptin receptor (Oprl1) spans the amino acid sequence from region 1-367.

Product Specifications

Product Name Alternative

Nociceptin receptor, K3 opiate receptor, Kappa-type 3 opioid receptor, KOR-3, ORGC, Orphanin FQ receptor

UniProt

P35377

Expression Region

1-367

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPLGLKVTIVGLYLAVCI GGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGNALC KTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGV PVAIMGSAQVEDEEIECLVEIPAPQDYWGPVFAICIFLFSFIIPVLIISVCYSLMIRRLR GVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLVQGLGVQPGSETAVAILRF CTALGYVNSCLNPILYAFLDENFKACFRKFCCASALHREMQVSDRVRSIAKDVGLGCKTS ETVPRPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Niclosamide Ethanolamine Salt
TRC-N395505-1G 1 g

Niclosamide Ethanolamine Salt

Sign In for Pricing
View Details
E Cadherin (CDH1) Mouse Monoclonal Antibody [Clone ID: 7H12]
AM06535SU-N 100 µL

E Cadherin (CDH1) Mouse Monoclonal Antibody [Clone ID: 7H12]

Sign In for Pricing
View Details
RHEB Recombinant Rabbit Monoclonal Antibody [JG37-12]
ET7108-44 100 µL

RHEB Recombinant Rabbit Monoclonal Antibody [JG37-12]

Sign In for Pricing
View Details
Pan-Lactyl-lysine Recombinant Rabbit monoclonal Antibody
HA750908 100 µL

Pan-Lactyl-lysine Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
RAP1B (NM_001010942) Human Recombinant Protein
TP321793 20 µg

RAP1B (NM_001010942) Human Recombinant Protein

Sign In for Pricing
View Details
GPN1 / XAB1 (DNA Repair & Protein Synthesis) (GPN1/2350), CF594 conjugate, 0.1mg/mL
BNC942350-100 1x 100 µL

GPN1 / XAB1 (DNA Repair & Protein Synthesis) (GPN1/2350), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details