Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Nociceptin receptor (Oprl1)

This Recombinant Mouse Nociceptin receptor (Oprl1) spans the amino acid sequence from region 1-367.

Product Specifications

Product Name Alternative

Nociceptin receptor, K3 opiate receptor, Kappa-type 3 opioid receptor, KOR-3, ORGC, Orphanin FQ receptor

UniProt

P35377

Expression Region

1-367

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MESLFPAPFWEVLYGSHFQGNLSLLNETVPHHLLLNASHSAFLPLGLKVTIVGLYLAVCI GGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGNALC KTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGV PVAIMGSAQVEDEEIECLVEIPAPQDYWGPVFAICIFLFSFIIPVLIISVCYSLMIRRLR GVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLVQGLGVQPGSETAVAILRF CTALGYVNSCLNPILYAFLDENFKACFRKFCCASALHREMQVSDRVRSIAKDVGLGCKTS ETVPRPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3124R), CF405S conjugate, 0.1mg/mL
BNC043124-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3124R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human AGBL2 activation kit by CRISPRa
GA112669 1 Kit

Human AGBL2 activation kit by CRISPRa

Sign In for Pricing
View Details
FAM166B (NM_001287239) Human Tagged ORF Clone
RG237345 10 µg

FAM166B (NM_001287239) Human Tagged ORF Clone

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS646769 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Rat CD44H Antibody[OX-49]
E-AB-F1225M1-01 50 Tests

Elab Fluor® 700 Anti-Rat CD44H Antibody[OX-49]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Rat CD44H Antibody[OX-49]
E-AB-F1225M1-02 100 Tests

Elab Fluor® 700 Anti-Rat CD44H Antibody[OX-49]

Sign In for Pricing
View Details