Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio G-protein coupled receptor 183-A (gpr183a)

This Recombinant Danio rerio G-protein coupled receptor 183-A (gpr183a) spans the amino acid sequence from region 1-368.

Product Specifications

Product Name Alternative

G-protein coupled receptor 183-A

UniProt

A5PLE7

Expression Region

1-368

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METTSANFTQNDSNVCTNLYNHRGWAQYFLPAMYSLICIVGLLGNVLALHVIWPNLKKIN STTLYSANLVVSDILFSLALPLRVVYYARGFDWPMGEGLCKAVALLFYINMYAGVNFMTC LSVDRFIAVVLPLRFSRFRKVQKVRYICGVVWVVVLMQTLPLLSMPMTNIEQSGHITCME YPNFEKIDNLPVMLIGAVVLGFGIPVITILVCYTALCLKLRHLAKSNKLTEKSGRSSKAI GVICTVILVFVVCYSPYHVDLLQYMIKKLRYDPDCSELHKFQISLHITVCFMNLNSCLDP FIYFFACKGYKKKVLKLLKKQVSMSFSSVVRTSPEGSSKDVFGNDKIQMNSRSFQKERSS VLLNSLEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL
BNC040225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF488A conjugate, 0.1mg/mL
BNC880861-500 1x 500 µL

HSP27 (G3.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL
BNC940352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
BNC401003-100 1x 100 µL

Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Catenin, gamma (Cardiomyocyte Marker) (rCTNG/1664), CF740 conjugate, 0.1mg/mL
BNC742156-500 1x 500 µL

Catenin, gamma (Cardiomyocyte Marker) (rCTNG/1664), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL
BNC740043-500 1x 500 µL

P21 / WAF1 (WA-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details