Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Somatostatin receptor type 2 (SSTR2)

This Recombinant Bovine Somatostatin receptor type 2 (SSTR2) spans the amino acid sequence from region 1-368.

Product Specifications

Product Name Alternative

Somatostatin receptor type 2, SS-2-R, SS2-R, SS2R, SRIF-1

UniProt

P34993

Expression Region

1-368

Origin

Bos taurus (Bovine)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDLVSELNETQPWLTTPFDLNGSVGAANISNQTEPYYDLASNVVLTFIYFVVCIIGLCGN TLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTV DGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWGVSLLVILPIMIYA GLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLTIICLCYLFIIIKVKSSGIR VGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVVLT YANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLL NGDLQTSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human AKAIN1 activation kit by CRISPRa
GA118666 1 Kit

Human AKAIN1 activation kit by CRISPRa

Sign In for Pricing
View Details
2-Bromo-2-propylpentanoic Acid Ethyl Ester
TRC-B686720-250MG 250 mg

2-Bromo-2-propylpentanoic Acid Ethyl Ester

Sign In for Pricing
View Details
Vps35l Mouse Gene Knockout Kit (CRISPR)
KN500505 1 Kit

Vps35l Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phenmetrazine Hydrochloride
TRC-P314500-10MG 10 mg

Phenmetrazine Hydrochloride

Sign In for Pricing
View Details
Laboratory Water Purification System BLPS-202
BLPS-202 1 Unit

Laboratory Water Purification System BLPS-202

Sign In for Pricing
View Details
c Fos (FOS) Mouse Monoclonal Antibody [Clone ID: OTI1E3]
CF806863 100 µg

c Fos (FOS) Mouse Monoclonal Antibody [Clone ID: OTI1E3]

Sign In for Pricing
View Details