Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galanin receptor type 3 (GALR3)

This Recombinant Human Galanin receptor type 3 (GALR3) spans the amino acid sequence from region 1-368.

Product Specifications

Product Name Alternative

Galanin receptor type 3, GAL3-R, GALR-3

UniProt

O60755

Expression Region

1-368

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADAQNISLDSPGSVGAVAVPVVFALIFLLGTVGNGLVLAVLLQPGPSAWQEPGSTTDLF ILNLAVADLCFILCCVPFQATIYTLDAWLFGALVCKAVHLLIYLTMYASSFTLAAVSVDR YLAVRHPLRSRALRTPRNARAAVGLVWLLAALFSAPYLSYYGTVRYGALELCVPAWEDAR RRALDVATFAAGYLLPVAVVSLAYGRTLRFLWAAVGPAGAAAAEARRRATGRAGRAMLAV AALYALCWGPHHALILCFWYGRFAFSPATYACRLASHCLAYANSCLNPLVYALASRHFRA RFRRLWPCGRRRRHRARRALRRVRPASSGPPGCPGDARPSGRLLAGGGQGPEPREGPVHG GEAARGPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ɑ-Butyric Acid-ω-Maleimidohexanamido PEG
135000-65-32.1G 1 g

Ɑ-Butyric Acid-ω-Maleimidohexanamido PEG

Sign In for Pricing
View Details
Human RNF222 activation kit by CRISPRa
GA118714 1 Kit

Human RNF222 activation kit by CRISPRa

Sign In for Pricing
View Details
Ptk2 Mouse Gene Knockout Kit (CRISPR)
KN514189 1 Kit

Ptk2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
APC Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]
E-AB-F1112UE-01 25 µg

APC Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]

Sign In for Pricing
View Details
APC Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]
E-AB-F1112UE-02 100 µg

APC Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]

Sign In for Pricing
View Details
C1qtnf3 Mouse Gene Knockout Kit (CRISPR)
KN502352 1 Kit

C1qtnf3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details