Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galanin receptor type 3 (GALR3)

This Recombinant Human Galanin receptor type 3 (GALR3) spans the amino acid sequence from region 1-368.

Product Specifications

Product Name Alternative

Galanin receptor type 3, GAL3-R, GALR-3

UniProt

O60755

Expression Region

1-368

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADAQNISLDSPGSVGAVAVPVVFALIFLLGTVGNGLVLAVLLQPGPSAWQEPGSTTDLF ILNLAVADLCFILCCVPFQATIYTLDAWLFGALVCKAVHLLIYLTMYASSFTLAAVSVDR YLAVRHPLRSRALRTPRNARAAVGLVWLLAALFSAPYLSYYGTVRYGALELCVPAWEDAR RRALDVATFAAGYLLPVAVVSLAYGRTLRFLWAAVGPAGAAAAEARRRATGRAGRAMLAV AALYALCWGPHHALILCFWYGRFAFSPATYACRLASHCLAYANSCLNPLVYALASRHFRA RFRRLWPCGRRRRHRARRALRRVRPASSGPPGCPGDARPSGRLLAGGGQGPEPREGPVHG GEAARGPE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apigenin 7-Glucuronide
TRC-A726505-1MG 1 mg

Apigenin 7-Glucuronide

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD90 Antibody[5E10]
E-AB-F1167M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD90 Antibody[5E10]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD90 Antibody[5E10]
E-AB-F1167M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD90 Antibody[5E10]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD90 Antibody[5E10]
E-AB-F1167M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD90 Antibody[5E10]

Sign In for Pricing
View Details
Zalutumumab Biosimilar - Research Grade
ICH5116-20mg 20 mg

Zalutumumab Biosimilar - Research Grade

Sign In for Pricing
View Details
BCL2L15 Antibody
KC-1852-01 50 μL

BCL2L15 Antibody

Sign In for Pricing
View Details