Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2T1 (OR2T1)

This Recombinant Human Olfactory receptor 2T1 (OR2T1) spans the amino acid sequence from region 1-369.

Product Specifications

Product Name Alternative

Olfactory receptor 2T1, Olfactory receptor 1-25, OR1-25, Olfactory receptor OR1-61

UniProt

O43869

Expression Region

1-369

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWQEYYFLNVFFPLLKVCCLTINSHVVILLPWECYHLIWKILPYIGTTVGSMEEYNTSST DFTFMGLFNRKETSGLIFAIISIIFFTALMANGVMIFLIQTDLRLHTPMYFLLSHLSLID MMYISTIVPKMLVNYLLDQRTISFVGCTAQHFLYLTLVGAEFFLLGLMAYDRYVAICNPL RYPVLMSRRVCWMIIAGSWFGGSLDGFLLTPITMSFPFCNSREINHFFCEAPAVLKLACA DTALYETVMYVCCVLMLLIPFSVVLASYARILTTVQCMSSVEGRKKAFATCSSHMTVVSL FYGAAMYTYMLPHSYHKPAQDKVLSVFYTILTPMLNPLIYSLRNKDVTGALKRALGRFKG PQRVSGGVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Ethyl Guanine-d5
TRC-E918652-5MG 5 mg

6-Ethyl Guanine-d5

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: bilateral
CS713237 5x 5 µm

Tissue FFPE Sections, Ovary: bilateral

Sign In for Pricing
View Details
Accuris High Fidelity DNA Polymerase, 1000 units
PR1000-HF-1000 1 Each

Accuris High Fidelity DNA Polymerase, 1000 units

Sign In for Pricing
View Details
Kallikrein 14 (KLK14) Rabbit Polyclonal Antibody
TA367115 100 µL

Kallikrein 14 (KLK14) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS505938 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Single Beam Visible Spectrophotometer BSSBV-201
BSSBV-201 Each

Single Beam Visible Spectrophotometer BSSBV-201

Sign In for Pricing
View Details