Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2T1 (OR2T1)

This Recombinant Human Olfactory receptor 2T1 (OR2T1) spans the amino acid sequence from region 1-369.

Product Specifications

Product Name Alternative

Olfactory receptor 2T1, Olfactory receptor 1-25, OR1-25, Olfactory receptor OR1-61

UniProt

O43869

Expression Region

1-369

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWQEYYFLNVFFPLLKVCCLTINSHVVILLPWECYHLIWKILPYIGTTVGSMEEYNTSST DFTFMGLFNRKETSGLIFAIISIIFFTALMANGVMIFLIQTDLRLHTPMYFLLSHLSLID MMYISTIVPKMLVNYLLDQRTISFVGCTAQHFLYLTLVGAEFFLLGLMAYDRYVAICNPL RYPVLMSRRVCWMIIAGSWFGGSLDGFLLTPITMSFPFCNSREINHFFCEAPAVLKLACA DTALYETVMYVCCVLMLLIPFSVVLASYARILTTVQCMSSVEGRKKAFATCSSHMTVVSL FYGAAMYTYMLPHSYHKPAQDKVLSVFYTILTPMLNPLIYSLRNKDVTGALKRALGRFKG PQRVSGGVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAF13 Antibody
8C11083-AAT 50 µg

TAF13 Antibody

Sign In for Pricing
View Details
NR1D2 Mouse Monoclonal Antibody [Clone ID: OTI3D4]
CF806588 100 µg

NR1D2 Mouse Monoclonal Antibody [Clone ID: OTI3D4]

Sign In for Pricing
View Details
AEBP2 Mouse Monoclonal Antibody [Clone ID: OTI8G9]
CF810230 100 µg

AEBP2 Mouse Monoclonal Antibody [Clone ID: OTI8G9]

Sign In for Pricing
View Details
COX5A Recombinant Rabbit monoclonal Antibody
HA723546 100 µL

COX5A Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
RICTOR Antibody (Biotin)
KB-2751-01 50 μL

RICTOR Antibody (Biotin)

Sign In for Pricing
View Details
RICTOR Antibody (Biotin)
KB-2751-02 100 µL

RICTOR Antibody (Biotin)

Sign In for Pricing
View Details