Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Somatostatin receptor type 2 (SSTR2)

This Recombinant Dog Somatostatin receptor type 2 (SSTR2) spans the amino acid sequence from region 1-369.

Product Specifications

Product Name Alternative

Somatostatin receptor type 2, SS-2-R, SS2-R, SS2R

UniProt

Q49LX6

Expression Region

1-369

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDMEYELLNESHTWVSPPFDLDGSVVAANSSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG NTLVIYVILRYAKMKTITNIYILNLAIAGELFMLGLPFLAMQVALVHWPFGKAICRVVMT VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMVNVAVWGVSLLVVLPIMIY AGLRSNQWGRSSCTINWPGESGTWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGI RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDLVVVL TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGPDDGERSDSKQDKSRLNETTETQRTL LNGDLQTSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Stomach
CS710881 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details
TBX18 Polyclonal Antibody
ABP56959-01 30 µL

TBX18 Polyclonal Antibody

Sign In for Pricing
View Details
TBX18 Polyclonal Antibody
ABP56959-02 100 µL

TBX18 Polyclonal Antibody

Sign In for Pricing
View Details
TBX18 Polyclonal Antibody
ABP56959-03 200 µL

TBX18 Polyclonal Antibody

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Fibulin 1 (FBLN1)
MBS2065952-01 0.1 mL

FITC-Linked Monoclonal Antibody to Fibulin 1 (FBLN1)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Fibulin 1 (FBLN1)
MBS2065952-02 0.2 mL

FITC-Linked Monoclonal Antibody to Fibulin 1 (FBLN1)

Sign In for Pricing
View Details