Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Somatostatin receptor type 2 (SSTR2)

This Recombinant Dog Somatostatin receptor type 2 (SSTR2) spans the amino acid sequence from region 1-369.

Product Specifications

Product Name Alternative

Somatostatin receptor type 2, SS-2-R, SS2-R, SS2R

UniProt

Q49LX6

Expression Region

1-369

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDMEYELLNESHTWVSPPFDLDGSVVAANSSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG NTLVIYVILRYAKMKTITNIYILNLAIAGELFMLGLPFLAMQVALVHWPFGKAICRVVMT VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMVNVAVWGVSLLVVLPIMIY AGLRSNQWGRSSCTINWPGESGTWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGI RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDLVVVL TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGPDDGERSDSKQDKSRLNETTETQRTL LNGDLQTSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMNLS Polyclonal Antibody
RA31077-01 50 µL

AMNLS Polyclonal Antibody

Sign In for Pricing
View Details
AMNLS Polyclonal Antibody
RA31077-02 100 µL

AMNLS Polyclonal Antibody

Sign In for Pricing
View Details
Rasl12 Rabbit Polyclonal Antibody (Biotin)
orb2102458 100 µL

Rasl12 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Rabbit Polyclonal PSP94/MSMB Antibody [DyLight 594]
NBP2-99576DL594 0.1 mL

Rabbit Polyclonal PSP94/MSMB Antibody [DyLight 594]

Sign In for Pricing
View Details
BSDC1 Antibody (C-term)
orb1934552-01 50 µL

BSDC1 Antibody (C-term)

Sign In for Pricing
View Details
BSDC1 Antibody (C-term)
orb1934552-02 100 µL

BSDC1 Antibody (C-term)

Sign In for Pricing
View Details