Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Somatostatin receptor type 2 (SSTR2)

This Recombinant Dog Somatostatin receptor type 2 (SSTR2) spans the amino acid sequence from region 1-369.

Product Specifications

Product Name Alternative

Somatostatin receptor type 2, SS-2-R, SS2-R, SS2R

UniProt

Q49LX6

Expression Region

1-369

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDMEYELLNESHTWVSPPFDLDGSVVAANSSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG NTLVIYVILRYAKMKTITNIYILNLAIAGELFMLGLPFLAMQVALVHWPFGKAICRVVMT VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMVNVAVWGVSLLVVLPIMIY AGLRSNQWGRSSCTINWPGESGTWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGI RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDLVVVL TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGPDDGERSDSKQDKSRLNETTETQRTL LNGDLQTSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AIH3 siRNA Oligos set (Human)
11602171 3x 5 nmol

AIH3 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Lentiviral human PTGR2 shRNA (UAS) - Lentiviral human PTGR2 shRNA (UAS, iRFP) (100)
GTR15156999 1 Vial

Lentiviral human PTGR2 shRNA (UAS) - Lentiviral human PTGR2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
CYP20A1 ORF Vector (Human) (pORF)
17322011 1.0 µg DNA

CYP20A1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
EMILIN1 Polyclonal Antibody
MBS128655-01 0.02 mL

EMILIN1 Polyclonal Antibody

Sign In for Pricing
View Details
EMILIN1 Polyclonal Antibody
MBS128655-02 0.1 mL

EMILIN1 Polyclonal Antibody

Sign In for Pricing
View Details
EMILIN1 Polyclonal Antibody
MBS128655-03 5x 0.1 mL

EMILIN1 Polyclonal Antibody

Sign In for Pricing
View Details