Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Somatostatin receptor type 2 (SSTR2)

This Recombinant Pig Somatostatin receptor type 2 (SSTR2) spans the amino acid sequence from region 1-369.

Product Specifications

Product Name Alternative

Somatostatin receptor type 2, SS-2-R, SS2-R, SS2R, SRIF-1

UniProt

P34994

Expression Region

1-369

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDMAYELLNGSQPWLSSPFDLNGSVATANSSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWGVSLLVILPIMIY AGLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLTIICLCYLFIIIKVKSSGI RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVVL TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTL LNGDLQTSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Porcine HAVCR1 Protein (hIgG1 Fc Tag)
PDMP100005-01 20 µg

Recombinant Porcine HAVCR1 Protein (hIgG1 Fc Tag)

Sign In for Pricing
View Details
Recombinant Porcine HAVCR1 Protein (hIgG1 Fc Tag)
PDMP100005-02 100 µg

Recombinant Porcine HAVCR1 Protein (hIgG1 Fc Tag)

Sign In for Pricing
View Details
Recombinant Porcine HAVCR1 Protein (hIgG1 Fc Tag)
PDMP100005-03 500 µg

Recombinant Porcine HAVCR1 Protein (hIgG1 Fc Tag)

Sign In for Pricing
View Details
Recombinant Porcine HAVCR1 Protein (hIgG1 Fc Tag)
PDMP100005-04 1 mg

Recombinant Porcine HAVCR1 Protein (hIgG1 Fc Tag)

Sign In for Pricing
View Details
Purified Anti-Human CD31 Antibody[158-2B3]
E-AB-F1050A-01 25 µg

Purified Anti-Human CD31 Antibody[158-2B3]

Sign In for Pricing
View Details
Purified Anti-Human CD31 Antibody[158-2B3]
E-AB-F1050A-02 100 µg

Purified Anti-Human CD31 Antibody[158-2B3]

Sign In for Pricing
View Details