Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Somatostatin receptor type 2 (Sstr2)

This Recombinant Mouse Somatostatin receptor type 2 (Sstr2) spans the amino acid sequence from region 1-369.

Product Specifications

Product Name Alternative

Somatostatin receptor type 2, SS-2-R, SS2-R, SS2R, SRIF-1

UniProt

P30875

Expression Region

1-369

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEMSSEQLNGSQVWVSSPFDLNGSLGPSNGSNQTEPYYDMTSNAVLTFIYFVVCVVGLCG NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWCVSLLVILPIMIY AGLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLTIICLCYLFIIIKVKSSGI RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVIL TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTEDGERSDSKQDKSRLNETTETQRTL LNGDLQTSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Treponema Pallidum rpoN Protein (aa 1-475)
VAng-Cr1282-1mgEcoli 1 mg (E. coli)

Recombinant Treponema Pallidum rpoN Protein (aa 1-475)

Sign In for Pricing
View Details
Syt3 Mouse shRNA Lentiviral Particle (Locus ID 20981)
TL502198V 500 µL Each

Syt3 Mouse shRNA Lentiviral Particle (Locus ID 20981)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae ATP synthase subunit a (atpB)
MBS7008748-01 0.02 mg

Recombinant Haemophilus influenzae ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae ATP synthase subunit a (atpB)
MBS7008748-02 0.1 mg

Recombinant Haemophilus influenzae ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae ATP synthase subunit a (atpB)
MBS7008748-03 5x 0.1 mg

Recombinant Haemophilus influenzae ATP synthase subunit a (atpB)

Sign In for Pricing
View Details
GET4 Protein Vector (Mouse) (pPM-C-His)
PV181725 500 ng

GET4 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details