Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Somatostatin receptor type 2 (Sstr2)

This Recombinant Mouse Somatostatin receptor type 2 (Sstr2) spans the amino acid sequence from region 1-369.

Product Specifications

Product Name Alternative

Somatostatin receptor type 2, SS-2-R, SS2-R, SS2R, SRIF-1

UniProt

P30875

Expression Region

1-369

Origin

Mus musculus (Mouse)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEMSSEQLNGSQVWVSSPFDLNGSLGPSNGSNQTEPYYDMTSNAVLTFIYFVVCVVGLCG NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMINVAVWCVSLLVILPIMIY AGLRSNQWGRSSCTINWPGESGAWYTGFIIYAFILGFLVPLTIICLCYLFIIIKVKSSGI RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSVAISPTPALKGMFDFVVIL TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTEDGERSDSKQDKSRLNETTETQRTL LNGDLQTSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

G-Protein-Coupled Receptor 182 (GPR182, Adrenomedullin L1 receptor , AM-R, g protein-coupled receptor g10d, G10D, hAMR, hrhamr, rAMR)
G8601-85A 50 µg

G-Protein-Coupled Receptor 182 (GPR182, Adrenomedullin L1 receptor , AM-R, g protein-coupled receptor g10d, G10D, hAMR, hrhamr, rAMR)

Sign In for Pricing
View Details
Phospho-Tyrosine Hydroxylase (Ser31) Antibody
CST 3370S 100 µL

Phospho-Tyrosine Hydroxylase (Ser31) Antibody

Sign In for Pricing
View Details
Rabbit anti- human Cytochrome c1, heme protein, mitochondrial polyclonal Antibody, Biotin conjugated
MBS715291-01 0.05 mg

Rabbit anti- human Cytochrome c1, heme protein, mitochondrial polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti- human Cytochrome c1, heme protein, mitochondrial polyclonal Antibody, Biotin conjugated
MBS715291-02 0.1 mg

Rabbit anti- human Cytochrome c1, heme protein, mitochondrial polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Rabbit anti- human Cytochrome c1, heme protein, mitochondrial polyclonal Antibody, Biotin conjugated
MBS715291-03 5x 0.1 mg

Rabbit anti- human Cytochrome c1, heme protein, mitochondrial polyclonal Antibody, Biotin conjugated

Sign In for Pricing
View Details
Sheep BUD13 homolog (BUD13) ELISA Kit
GTR10360570 96 Well

Sheep BUD13 homolog (BUD13) ELISA Kit

Sign In for Pricing
View Details