Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anolis carolinensis Red-sensitive opsin

This Recombinant Anolis carolinensis Red-sensitive opsin spans the amino acid sequence from region 1-369.

Product Specifications

Product Name Alternative

Red-sensitive opsin, Red cone photoreceptor pigment

UniProt

P41592

Expression Region

1-369

Origin

Anolis carolinensis (Green anole) (American chameleon)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGTVTEAWDVAVFAARRRNDEDDTTRDSLFTYTNSNNTRGPFEGPNYHIAPRWVYNITS VWMIFVVIASIFTNGLVLVATAKFKKLRHPLNWILVNLAIADLGETVIASTISVINQISG YFILGHPMCVLEGYTVSTCGISALWSLAVISWERWVVVCKPFGNVKFDAKLAVAGIVFSW VWSAVWTAPPVFGWSRYWPHGLKTSCGPDVFSGSDDPGVLSYMIVLMITCCFIPLAVILL CYLQVWLAIRAVAAQQKESESTQKAEKEVSRMVVVMIIAYCFCWGPYTVFACFAAANPGY AFHPLAAALPAYFAKSATIYNPIIYVFMNRQFRNCIMQLFGKKVDDGSELSSTSRTEVSS VSNSSVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPV-16 (Human Papilloma Virus 16) (HPV16/1295), CF594 conjugate, 0.1mg/mL
BNC941295-100 1x 100 µL

HPV-16 (Human Papilloma Virus 16) (HPV16/1295), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lactal Hexaacetate
TRC-L112500-1G 1 g

Lactal Hexaacetate

Sign In for Pricing
View Details
rac 3-Hydroxybutyric Acid-13C4 Sodium Salt
TRC-H833024-5MG 5 mg

rac 3-Hydroxybutyric Acid-13C4 Sodium Salt

Sign In for Pricing
View Details
Mix-n-StainTM CF®568 Antibody Labeling Kit, 3x (5-20ug) labeling
#92447 1 Kit

Mix-n-StainTM CF®568 Antibody Labeling Kit, 3x (5-20ug) labeling

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD31 Antibody[390]
E-AB-F11800-01 100 µg

AF/LE Purified Anti-Mouse CD31 Antibody[390]

Sign In for Pricing
View Details
AF/LE Purified Anti-Mouse CD31 Antibody[390]
E-AB-F11800-02 1 mg

AF/LE Purified Anti-Mouse CD31 Antibody[390]

Sign In for Pricing
View Details