Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anolis carolinensis Red-sensitive opsin

This Recombinant Anolis carolinensis Red-sensitive opsin spans the amino acid sequence from region 1-369.

Product Specifications

Product Name Alternative

Red-sensitive opsin, Red cone photoreceptor pigment

UniProt

P41592

Expression Region

1-369

Origin

Anolis carolinensis (Green anole) (American chameleon)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGTVTEAWDVAVFAARRRNDEDDTTRDSLFTYTNSNNTRGPFEGPNYHIAPRWVYNITS VWMIFVVIASIFTNGLVLVATAKFKKLRHPLNWILVNLAIADLGETVIASTISVINQISG YFILGHPMCVLEGYTVSTCGISALWSLAVISWERWVVVCKPFGNVKFDAKLAVAGIVFSW VWSAVWTAPPVFGWSRYWPHGLKTSCGPDVFSGSDDPGVLSYMIVLMITCCFIPLAVILL CYLQVWLAIRAVAAQQKESESTQKAEKEVSRMVVVMIIAYCFCWGPYTVFACFAAANPGY AFHPLAAALPAYFAKSATIYNPIIYVFMNRQFRNCIMQLFGKKVDDGSELSSTSRTEVSS VSNSSVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SHE activation kit by CRISPRa
GA114959 1 Kit

Human SHE activation kit by CRISPRa

Sign In for Pricing
View Details
RAIDD (CRADD) Mouse Monoclonal Antibody [Clone ID: AT14G8]
AM50351PU-N 100 µL

RAIDD (CRADD) Mouse Monoclonal Antibody [Clone ID: AT14G8]

Sign In for Pricing
View Details
Recombinant Human FGF18 protein (His tag)
PDEH101057-01 20 µg

Recombinant Human FGF18 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human FGF18 protein (His tag)
PDEH101057-02 100 µg

Recombinant Human FGF18 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human FGF18 protein (His tag)
PDEH101057-03 500 µg

Recombinant Human FGF18 protein (His tag)

Sign In for Pricing
View Details
Recombinant Human FGF18 protein (His tag)
PDEH101057-04 1 mg

Recombinant Human FGF18 protein (His tag)

Sign In for Pricing
View Details