Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anolis carolinensis Red-sensitive opsin

This Recombinant Anolis carolinensis Red-sensitive opsin spans the amino acid sequence from region 1-369.

Product Specifications

Product Name Alternative

Red-sensitive opsin, Red cone photoreceptor pigment

UniProt

P41592

Expression Region

1-369

Origin

Anolis carolinensis (Green anole) (American chameleon)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGTVTEAWDVAVFAARRRNDEDDTTRDSLFTYTNSNNTRGPFEGPNYHIAPRWVYNITS VWMIFVVIASIFTNGLVLVATAKFKKLRHPLNWILVNLAIADLGETVIASTISVINQISG YFILGHPMCVLEGYTVSTCGISALWSLAVISWERWVVVCKPFGNVKFDAKLAVAGIVFSW VWSAVWTAPPVFGWSRYWPHGLKTSCGPDVFSGSDDPGVLSYMIVLMITCCFIPLAVILL CYLQVWLAIRAVAAQQKESESTQKAEKEVSRMVVVMIIAYCFCWGPYTVFACFAAANPGY AFHPLAAALPAYFAKSATIYNPIIYVFMNRQFRNCIMQLFGKKVDDGSELSSTSRTEVSS VSNSSVSPA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trim26 Mouse Gene Knockout Kit (CRISPR)
KN518194 1 Kit

Trim26 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rrad Mouse Gene Knockout Kit (CRISPR)
KN515128 1 Kit

Rrad Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Hsp60 (HSPD1) Mouse Monoclonal Antibody [Clone ID: SPM253]
AM50115PU-S 100 µg

Hsp60 (HSPD1) Mouse Monoclonal Antibody [Clone ID: SPM253]

Sign In for Pricing
View Details
HOXA5 Rabbit Polyclonal Antibody
TA371826 100 µL

HOXA5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
S100A2 Polyclonal Antibody
E-AB-90439-01 60 µL

S100A2 Polyclonal Antibody

Sign In for Pricing
View Details
S100A2 Polyclonal Antibody
E-AB-90439-02 120 µL

S100A2 Polyclonal Antibody

Sign In for Pricing
View Details