Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lysophosphatidic acid receptor 4 (Lpar4)

This Recombinant Mouse Lysophosphatidic acid receptor 4 (Lpar4) spans the amino acid sequence from region 1-370.

Product Specifications

Product Name Alternative

Lysophosphatidic acid receptor 4, LPA receptor 4, LPA-4, G-protein coupled receptor 23, P2Y purinoceptor 9, P2Y9, Purinergic receptor 9

UniProt

Q8BLG2

Expression Region

1-370

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDRRFIDFQFQDLNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSAS LFVFCFRMKMRSETAIFITNLALSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLT NIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTN VNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQI GTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCLLERFAKIMYPITLCLA TLNCCFDPFIYYFTLESFQKSFYINTHIRMESLFKTETPLTPKPSLPAIQEEVSDQTTNN GGELMLESTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MALT1 (MALT-Lymphoma Marker) (MT1/3159R), CF405S conjugate, 0.1mg/mL
BNC043159-100 1x 100 µL

MALT1 (MALT-Lymphoma Marker) (MT1/3159R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Protein Lysate, Prostate
CP565641 150 µg

Tissue Protein Lysate, Prostate

Sign In for Pricing
View Details
Recombinant GTPBP4 Antibody
RC-5732-01 50 μL

Recombinant GTPBP4 Antibody

Sign In for Pricing
View Details
Recombinant GTPBP4 Antibody
RC-5732-02 100 µL

Recombinant GTPBP4 Antibody

Sign In for Pricing
View Details
Recombinant GTPBP4 Antibody
RC-5732-03 1 mL

Recombinant GTPBP4 Antibody

Sign In for Pricing
View Details
Rat Interleukin 18 (IL18) ELISA Kit
RDR-IL18-Ra-01 96 Tests

Rat Interleukin 18 (IL18) ELISA Kit

Sign In for Pricing
View Details