Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Lysophosphatidic acid receptor 4 (Lpar4)

This Recombinant Mouse Lysophosphatidic acid receptor 4 (Lpar4) spans the amino acid sequence from region 1-370.

Product Specifications

Product Name Alternative

Lysophosphatidic acid receptor 4, LPA receptor 4, LPA-4, G-protein coupled receptor 23, P2Y purinoceptor 9, P2Y9, Purinergic receptor 9

UniProt

Q8BLG2

Expression Region

1-370

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGDRRFIDFQFQDLNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSAS LFVFCFRMKMRSETAIFITNLALSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLT NIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTN VNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQI GTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCLLERFAKIMYPITLCLA TLNCCFDPFIYYFTLESFQKSFYINTHIRMESLFKTETPLTPKPSLPAIQEEVSDQTTNN GGELMLESTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK3 beta (GSK3B) Rabbit Polyclonal Antibody
AP06391PU-N 100 µg

GSK3 beta (GSK3B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Platinum On Carbon (10 wt. %)
TRC-P578005-5G 5 g

Platinum On Carbon (10 wt. %)

Sign In for Pricing
View Details
2-Bromopyridine N-Oxide Hydrochloride
TRC-B698835-250MG 250 mg

2-Bromopyridine N-Oxide Hydrochloride

Sign In for Pricing
View Details
Mono-7-carboxyheptyl Phthalate
TRC-M525580-25MG 25 mg

Mono-7-carboxyheptyl Phthalate

Sign In for Pricing
View Details
Calretinin Recombinant Rabbit Monoclonal Antibody [JM12-93]
ET1705-19 100 µL

Calretinin Recombinant Rabbit Monoclonal Antibody [JM12-93]

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Cytokeratin,  30nm
GM-30-30 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Cytokeratin, 30nm

Sign In for Pricing
View Details