Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat 5-hydroxytryptamine receptor 5B (Htr5b)

This Recombinant Rat 5-hydroxytryptamine receptor 5B (Htr5b) spans the amino acid sequence from region 1-370.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 5B, 5-HT-5B, 5-HT5B, MR22, Serotonin receptor 5B

UniProt

P35365

Expression Region

1-370

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVSNLSGATPGIAFPPGPESCSDSPSSGRSMGSTPGGLILSGREPPFSAFTVLVVTLLV LLIAATFLWNLLVLVTILRVRAFHRVPHNLVASTAVSDVLVAALVMPLSLVSELSAGRRW QLGRSLCHVWISFDVLCCTASIWNVAAIALDRYWTITRHLQYTLRTRRRASALMIAITWA LSALIALAPLLFGWGEAYDARLQRCQVSQEPSYAVFSTCGAFYVPLAVVLFVYWKIYKAA KFRFGRRRRAVVPLPATTQAKEAPQESETVFTARCRATVAFQTSGDSWREQKEKRAAMMV GILIGVFVLCWIPFFLTELVSPLCACSLPPIWKSIFLWLGYSNSFFNPLIYTAFNKNYNN AFKSLFTKQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dynamin 2 (DNM2) Rabbit Monoclonal Antibody
TA423210 100 µL

Dynamin 2 (DNM2) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Polystyrene A PHB
HA40045013.100G 100 g

Polystyrene A PHB

Sign In for Pricing
View Details
Human Resistin (RETN) activation kit by CRISPRa
GA111224 1 Kit

Human Resistin (RETN) activation kit by CRISPRa

Sign In for Pricing
View Details
Rab4 (RAB4A) Human Gene Knockout Kit (CRISPR)
KN402572 1 Kit

Rab4 (RAB4A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NCOA4 (NM_001145262) Human Over-expression Lysate
LC428770 20 µg

NCOA4 (NM_001145262) Human Over-expression Lysate

Sign In for Pricing
View Details
BioCoupler® Glass Set (16 oz) x12
BCS1612 12 Each

BioCoupler® Glass Set (16 oz) x12

Sign In for Pricing
View Details