Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat 5-hydroxytryptamine receptor 5B (Htr5b)

This Recombinant Rat 5-hydroxytryptamine receptor 5B (Htr5b) spans the amino acid sequence from region 1-370.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 5B, 5-HT-5B, 5-HT5B, MR22, Serotonin receptor 5B

UniProt

P35365

Expression Region

1-370

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVSNLSGATPGIAFPPGPESCSDSPSSGRSMGSTPGGLILSGREPPFSAFTVLVVTLLV LLIAATFLWNLLVLVTILRVRAFHRVPHNLVASTAVSDVLVAALVMPLSLVSELSAGRRW QLGRSLCHVWISFDVLCCTASIWNVAAIALDRYWTITRHLQYTLRTRRRASALMIAITWA LSALIALAPLLFGWGEAYDARLQRCQVSQEPSYAVFSTCGAFYVPLAVVLFVYWKIYKAA KFRFGRRRRAVVPLPATTQAKEAPQESETVFTARCRATVAFQTSGDSWREQKEKRAAMMV GILIGVFVLCWIPFFLTELVSPLCACSLPPIWKSIFLWLGYSNSFFNPLIYTAFNKNYNN AFKSLFTKQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Oxo-12alpha-hydroxy-5beta-cholanoic Acid
TRC-O856870-250MG 250 mg

3-Oxo-12alpha-hydroxy-5beta-cholanoic Acid

Sign In for Pricing
View Details
Tissue FFPE Sections, Smooth muscle
CS801348 5x 5 µm

Tissue FFPE Sections, Smooth muscle

Sign In for Pricing
View Details
Recombinant Klebsiella pneumoniae NEO Protein
PKSQ050062-01 10 µg

Recombinant Klebsiella pneumoniae NEO Protein

Sign In for Pricing
View Details
Recombinant Klebsiella pneumoniae NEO Protein
PKSQ050062-02 50 µg

Recombinant Klebsiella pneumoniae NEO Protein

Sign In for Pricing
View Details
Phytanoic Acid
TRC-P147200-500MG 500 mg

Phytanoic Acid

Sign In for Pricing
View Details
Human Resistin Recombinant Rabbit monoclonal Antibody
HA723661 100 µL

Human Resistin Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details