Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse 5-hydroxytryptamine receptor 5B (Htr5b)

This Recombinant Mouse 5-hydroxytryptamine receptor 5B (Htr5b) spans the amino acid sequence from region 1-370.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 5B, 5-HT-5B, 5-HT5B, Serotonin receptor 5B

UniProt

P31387

Expression Region

1-370

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEVSNLSGATPGLAFPPGPESCSDSPSSGRSMGSTPGGLILPGREPPFSAFTVLVVTLLV LLIAATFLWNLLVLVTILRVRAFHRVPHNLVASTAVSDVLVAVLVMPLSLVSELSAGRRW QLGRSLCHVWISFDVLCCTASIWNVAAIALDRYWTITRHLQYTLRTRSRASALMIAITWA LSALIALAPLLFGWGEAYDARLQRCQVSQEPSYAVFSTCGAFYLPLAVVLFVYWKIYKAA KFRFGRRRRAVVPLPATTQAKEAPPESEMVFTARRRATVTFQTSGDSWREQKEKRAAMMV GILIGVFVLCWIPFFLTELISPLCACSLPPIWKSIFLWLGYSNSFFNPLIYTAFNKNYNN AFKSLFTKQR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPM1A Antibody
MBS9212709-01 0.08 mL

PPM1A Antibody

Sign In for Pricing
View Details
PPM1A Antibody
MBS9212709-02 0.4 mL

PPM1A Antibody

Sign In for Pricing
View Details
PPM1A Antibody
MBS9212709-03 5x 0.4 mL

PPM1A Antibody

Sign In for Pricing
View Details
BEND5 Rabbit Polyclonal Antibody
orb258211 100 µg

BEND5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RICTOR, NT (Rapamycin-insensitive Companion of mTOR, AVO3 Homolog, hAVO3, KIAA1999) (HRP) discontinued
R2031-62M-HRP 200 µL

RICTOR, NT (Rapamycin-insensitive Companion of mTOR, AVO3 Homolog, hAVO3, KIAA1999) (HRP) discontinued

Sign In for Pricing
View Details
Mouse RES protein
orb382968-01 20 µg

Mouse RES protein

Sign In for Pricing
View Details