Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 85 (Gpr85)

This Recombinant Mouse Probable G-protein coupled receptor 85 (Gpr85) spans the amino acid sequence from region 1-370.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 85, Super conserved receptor expressed in brain 2

UniProt

P60894

Expression Region

1-370

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANYSHAADNILQNLSPLTAFLKLTSLGFIIGVSVVGNLLISILLVKDKTLHRAPYYFLL DLCCSDILRSAICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCFHTAFMLFCISVTRY LAIAHHRFYTKRLTFWTCLAVICMVWTLSVAMAFPPVLDVGTYSFIREEDQCTFQHRSFR ANDSLGFMLLLALILLATQLVYLKLIFFVHDRRKMKPVQFVAAVSQNWTFHGPGASGQAA ANWLAGFGRGPTPPTLLGIRQNANTTGRRRLLVLDEFKMEKRISRMFYIMTFLFLTLWGP YLVACYWRVFARGPVVPGGFLTAAVWMSFAQAGINPFVCIFSNRELRRCFSTTLLYCRKS RLPREPYCVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSTCD (NM_001031720) Human Over-expression Lysate
LY422170 100 µg

GSTCD (NM_001031720) Human Over-expression Lysate

Sign In for Pricing
View Details
Vaccum Pump BVAP-303
BVAP-303 1 Unit

Vaccum Pump BVAP-303

Sign In for Pricing
View Details
Fas (TNFRSF6) associated factor 1 (CPTC-FAF1-2), CF568 conjugate, 0.1mg/mL
BNC682268-100 1x 100 µL

Fas (TNFRSF6) associated factor 1 (CPTC-FAF1-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB602816 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
PPP1R14A Mouse Monoclonal Antibody [Clone ID: 4H10]
AM03185PU-S 50 µL

PPP1R14A Mouse Monoclonal Antibody [Clone ID: 4H10]

Sign In for Pricing
View Details
HMGCR Antibody
KC-1473-01 50 μL

HMGCR Antibody

Sign In for Pricing
View Details