Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable G-protein coupled receptor 85 (Gpr85)

This Recombinant Mouse Probable G-protein coupled receptor 85 (Gpr85) spans the amino acid sequence from region 1-370.

Product Specifications

Product Name Alternative

Probable G-protein coupled receptor 85, Super conserved receptor expressed in brain 2

UniProt

P60894

Expression Region

1-370

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MANYSHAADNILQNLSPLTAFLKLTSLGFIIGVSVVGNLLISILLVKDKTLHRAPYYFLL DLCCSDILRSAICFPFVFNSVKNGSTWTYGTLTCKVIAFLGVLSCFHTAFMLFCISVTRY LAIAHHRFYTKRLTFWTCLAVICMVWTLSVAMAFPPVLDVGTYSFIREEDQCTFQHRSFR ANDSLGFMLLLALILLATQLVYLKLIFFVHDRRKMKPVQFVAAVSQNWTFHGPGASGQAA ANWLAGFGRGPTPPTLLGIRQNANTTGRRRLLVLDEFKMEKRISRMFYIMTFLFLTLWGP YLVACYWRVFARGPVVPGGFLTAAVWMSFAQAGINPFVCIFSNRELRRCFSTTLLYCRKS RLPREPYCVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VSIG1 Rabbit Polyclonal Antibody
TA372059 100 µL

VSIG1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ces3a Mouse Gene Knockout Kit (CRISPR)
KN503200 1 Kit

Ces3a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Uqcrc2 Mouse Gene Knockout Kit (CRISPR)
KN518741 1 Kit

Uqcrc2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pallidin (BLOC1S6) (NM_012388) Human Over-expression Lysate
LC402203 20 µg

Pallidin (BLOC1S6) (NM_012388) Human Over-expression Lysate

Sign In for Pricing
View Details
Annexin A10 Antibody
KC-1304-01 50 μL

Annexin A10 Antibody

Sign In for Pricing
View Details
Annexin A10 Antibody
KC-1304-02 100 µL

Annexin A10 Antibody

Sign In for Pricing
View Details