Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Galanin receptor type 3 (Galr3)

This Recombinant Mouse Galanin receptor type 3 (Galr3) spans the amino acid sequence from region 1-370.

Product Specifications

Product Name Alternative

Galanin receptor type 3, GAL3-R, GALR-3

UniProt

O88853

Expression Region

1-370

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADIQNISLDSPGSVGAVAVPVVFALIFLLGMVGNGLVLAVLLQPGPSAWQEPGSTTDLF ILNLAVADLCFILCCVPFQAAIYTLDAWLFGAFVCKTVHLLIYLTMYASSFTLAAVSVDR YLAVRHPLRSRALRTPRNARAAVGLVWLLAALFSAPYLSYYGTVRYGALELCVPAWEDAR RRALDVATFAAGYLLPVTVVSLAYGRTLCFLWAAVGPAGAAAAEARRRATGRAGRAMLTV AALYALCWGPHHALILCFWYGRFAFSPATYACRLASHCLAYANSCLNPLVYSLASRHFRA RFRRLWPCGHRRHRHHHHRLHRALRRVQPASSGPAGYPGDARPRGWSMEPRGDALRGGET RLTLSARGPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human COX7A1 activation kit by CRISPRa
GA100938 1 Kit

Human COX7A1 activation kit by CRISPRa

Sign In for Pricing
View Details
KCNK10 (NM_138317) Human Over-expression Lysate
LY403348 100 µg

KCNK10 (NM_138317) Human Over-expression Lysate

Sign In for Pricing
View Details
LRSAM1 (NM_138361) Human Recombinant Protein
TP315025 20 µg

LRSAM1 (NM_138361) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS505073 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Mouse Lipase, Hormone Sensitive (LIPE) ELISA Kit
RDR-LIPE-Mu-01 96 Tests

Mouse Lipase, Hormone Sensitive (LIPE) ELISA Kit

Sign In for Pricing
View Details
Mouse Lipase, Hormone Sensitive (LIPE) ELISA Kit
RDR-LIPE-Mu-02 48 Tests

Mouse Lipase, Hormone Sensitive (LIPE) ELISA Kit

Sign In for Pricing
View Details