Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Putative gustatory receptor 39a, isoform A (Gr39a)

This Recombinant Drosophila melanogaster Putative gustatory receptor 39a, isoform A (Gr39a) spans the amino acid sequence from region 1-371.

Product Specifications

Product Name Alternative

Putative gustatory receptor 39a, isoform A

UniProt

P58959

Expression Region

1-371

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKVCRDLRIYLRLLHIMGMMCWHFDSDHCQLVATSGSERYAVVYAGCILVSTTAGFIFA LLHPSRFHIAIYNQTGNFYEAVIFRSTCVVLFLVYVILYAWRHRYRDLVQHILRLNRRCA SSCTNQQFLHNIILYGMLTILCFGNYLHGYTRAGLATLPLALCMLVYIFAFLVLCLLLMF FVSLKQVMTAGLIHYNQQLCQGDLISGLRGRQQILKLCGGELNECFGLLMLPIVALVLLM APSGPFFLISTVLEGKFRPDECLIMLLTSSTWDTPWMIMLVLMLRTNGISEEANKTAKML TKVPRTGTGLDRMIEKFLLKNLRQKPILTAYGFFALDKSTLFKLFTAIFTYMVILVQFKE MENSTKSINKF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD79a (B-Cell Marker) (rIGA/764), CF640R conjugate, 0.1mg/mL
BNC401862-100 1x 100 µL

CD79a (B-Cell Marker) (rIGA/764), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (136-4B5), CF647 conjugate, 0.1mg/mL
BNC470173-100 1x 100 µL

CD45 / LCA (136-4B5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL
BNC470225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (IGA/515), CF405S conjugate, 0.1mg/mL
BNC040515-100 1x 100 µL

CD79a (IGA/515), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), CF594 conjugate, 0.1mg/mL
BNC941930-100 1x 100 µL

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2760), CF568 conjugate, 0.1mg/mL
BNC682760-100 1x 100 µL

BARX1 (Prognostic Biomarker in Hepatocellular Carcinoma) (BARX1/2760), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details