Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized MscS family protein YhdY (yhdY)

This Recombinant Bacillus subtilis Uncharacterized MscS family protein YhdY (yhdY) spans the amino acid sequence from region 1-371.

Product Specifications

Product Name Alternative

Uncharacterized MscS family protein YhdY

UniProt

O07594

Expression Region

1-371

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPDYLQQYFTLDNIIQIGISLAILLVFLILRKLFTRYFFNLLFNLTNRPKTEIFKQVVLA FDKPARWFFVALGLFLAIRYSPFLDEQMPVISKIYRSLIVALLCWGLCNLTATSSFIFHK VNQRFELDMDDILAPFLSKLLRFVIIALSVSVIAQEFNYDVNGFVAGLGLGGLAFALAAK DTISNFFGGIIIITEKPFTIGDWVETSTVTGSVEDITFRSTRFRTAQGALVTVPNSTLSM EAITNWTRMTKRQITFSIHVSYATPIENLERSIHSLRTMLLEHEGVDNEIIMVNFDTFAD SYYNLFFNFYTKTTVWAENLNIREDINYKIIEILGAEGVQFAYPGQMVVVKQKHESDQFQ VNLNKEEKERA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD53 (161-2), CF568 conjugate, 0.1mg/mL
BNC680324-500 1x 500 µL

CD53 (161-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF740 conjugate, 0.1mg/mL
BNC740160-500 1x 500 µL

CD20 (B9E9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL
BNC680008-500 1x 500 µL

MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Granulocyte Marker (BM-1), CF594 conjugate, 0.1mg/mL
BNC940061-500 1x 500 µL

Granulocyte Marker (BM-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (B33/20), CF405S conjugate, 0.1mg/mL
BNC040952-100 1x 100 µL

Human IgG Immunoglobulin (B33/20), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), Biotin conjugate, 0.1mg/mL
BNCB0176-500 1x 500 µL

CD5 (Cris-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details